Lineage for d2ve6b_ (2ve6 B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 931882Protein beta2-microglobulin [88600] (5 species)
  7. 932374Species Mouse (Mus musculus) [TaxId:10090] [88603] (142 PDB entries)
    Uniprot P01887
  8. 932523Domain d2ve6b_: 2ve6 B: [161573]
    Other proteins in same PDB: d2ve6a1, d2ve6a2, d2ve6d1, d2ve6d2, d2ve6g1, d2ve6g2, d2ve6j1, d2ve6j2
    automated match to d1ddhb_

Details for d2ve6b_

PDB Entry: 2ve6 (more details), 2.65 Å

PDB Description: crystal structure of a murine mhc class i h2-db molecule in complex with a photocleavable peptide
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d2ve6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ve6b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
mqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhasmaepktvywdrdm

SCOPe Domain Coordinates for d2ve6b_:

Click to download the PDB-style file with coordinates for d2ve6b_.
(The format of our PDB-style files is described here.)

Timeline for d2ve6b_: