SCOPe 2.07: Domain d2vdqa_: 2vdq A:

Lineage for d2vdqa_ (2vdq A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (2 families)

5. Family b.69.8.1: Integrin alpha N-terminal domain [69319] (2 proteins)

6. Protein Integrin alpha N-terminal domain [69320] (2 species)

7. Species Human (Homo sapiens), isoform IIb [TaxId:9606] [117285] (24 PDB entries)
   Uniprot P08514 32-483

8. Domain d2vdqa_: 2vdq A: [161571]
   Other proteins in same PDB: d2vdqh1
   automated match to d1tyea_
   complexed with ca, gol, mg, nag

Details for d2vdqa_

PDB Entry: 2vdq, 2.59 Å

PDB Description: integrin alphaiibbeta3 headpiece bound to a chimeric fibrinogen gamma chain peptide, hhlggakqrgdv

PDB Compounds: (A:) integrin alpha-IIb

SCOPe Domain Sequences for d2vdqa_:

Sequence; same for both SEQRES and ATOM records:

>d2vdqa_ b.69.8.1 (A:) Integrin alpha N-terminal domain {Human (Homo sapiens), isoform IIb [TaxId: 9606]}
lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra
eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte
eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage
lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva
vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlrgeqmasyfghsvavtdvng
dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai
aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs
lrgavdiddngypdlivgayganqvavyraqp

Timeline for d2vdqa_:

• d2vdqa_ first appeared in SCOPe 2.01
  
• d2vdqa_ appears in SCOPe 2.06
  
• d2vdqa_ appears in the current release, SCOPe 2.08