Lineage for d2vdma_ (2vdm A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2075644Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2076199Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (2 families) (S)
  5. 2076200Family b.69.8.1: Integrin alpha N-terminal domain [69319] (2 proteins)
  6. 2076201Protein Integrin alpha N-terminal domain [69320] (2 species)
  7. 2076202Species Human (Homo sapiens), isoform IIb [TaxId:9606] [117285] (24 PDB entries)
    Uniprot P08514 32-483
  8. 2076222Domain d2vdma_: 2vdm A: [161567]
    Other proteins in same PDB: d2vdmh1, d2vdml1, d2vdml2
    automated match to d1tyea_
    complexed with agg, ca, gol, mg, nag

Details for d2vdma_

PDB Entry: 2vdm (more details), 2.9 Å

PDB Description: re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist tirofiban
PDB Compounds: (A:) integrin alpha-IIb

SCOPe Domain Sequences for d2vdma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vdma_ b.69.8.1 (A:) Integrin alpha N-terminal domain {Human (Homo sapiens), isoform IIb [TaxId: 9606]}
lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra
eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte
eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage
lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva
vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlrgeqmasyfghsvavtdvng
dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai
aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs
lrgavdiddngypdlivgayganqvavyraqp

SCOPe Domain Coordinates for d2vdma_:

Click to download the PDB-style file with coordinates for d2vdma_.
(The format of our PDB-style files is described here.)

Timeline for d2vdma_: