SCOPe 2.06: Domain d2ra0l_: 2ra0 L:

Lineage for d2ra0l_ (2ra0 L:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Factor X, N-terminal module [57205] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57206] (85 PDB entries)
   Uniprot P00742 127-178

8. Domain d2ra0l_: 2ra0 L: [161545]
   Other proteins in same PDB: d2ra0a_
   automated match to d1g2lb_
   complexed with jnj

Details for d2ra0l_

PDB Entry: 2ra0, 2.3 Å

PDB Description: x-ray structure of fxa in complex with 7-fluoroindazole

PDB Compounds: (L:) coagulation factor x

SCOPe Domain Sequences for d2ra0l_:

Sequence; same for both SEQRES and ATOM records:

>d2ra0l_ g.3.11.1 (L:) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]}
vcsldngdcdqfcheeqnsvvcscargytladngkaciptgpypcgkqtle

Timeline for d2ra0l_:

• d2ra0l_ first appeared in SCOPe 2.01
  
• d2ra0l_ appears in SCOPe 2.05
  
• d2ra0l_ appears in SCOPe 2.07
  
• d2ra0l_ appears in the current release, SCOPe 2.08