SCOP 1.63: Domain d1cf7b_: 1cf7 B:

Lineage for d1cf7b_ (1cf7 B:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (36 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.17: Cell cycle transcription factor e2f-dp [46847] (1 protein)

6. Protein Cell cycle transcription factor e2f-dp [46848] (1 species)
   heterodimer of two homologous chains

7. Species Human (Homo sapiens) [TaxId:9606] [46849] (1 PDB entry)

8. Domain d1cf7b_: 1cf7 B: [16152]

Details for d1cf7b_

PDB Entry: 1cf7, 2.6 Å

PDB Description: structural basis of dna recognition by the heterodimeric cell cycle transcription factor e2f-dp

SCOP Domain Sequences for d1cf7b_:

Sequence; same for both SEQRES and ATOM records:

>d1cf7b_ a.4.5.17 (B:) Cell cycle transcription factor e2f-dp {Human (Homo sapiens)}
gkglrhfsmkvcekvqrkgttsynevadelvseftnsnnhlaadsaydqknirrrvydal
nvlmamniiskekkeikwiglp

Timeline for d1cf7b_:

• d1cf7b_ first appeared (with stable ids) in SCOP 1.55
  
• d1cf7b_ appears in SCOP 1.61
  
• d1cf7b_ appears in SCOP 1.65
  
• d1cf7b_ appears in the current release, SCOPe 2.08