Lineage for d1cf7a_ (1cf7 A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 277521Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 277839Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (36 families) (S)
    contains a small beta-sheet (wing)
  5. 278022Family a.4.5.17: Cell cycle transcription factor e2f-dp [46847] (2 proteins)
    heterodimer of two homologous chains
  6. 278026Protein Cell cycle transcription factor E2F-4 [88652] (1 species)
  7. 278027Species Human (Homo sapiens) [TaxId:9606] [88653] (1 PDB entry)
  8. 278028Domain d1cf7a_: 1cf7 A: [16151]
    Other proteins in same PDB: d1cf7b_

Details for d1cf7a_

PDB Entry: 1cf7 (more details), 2.6 Å

PDB Description: structural basis of dna recognition by the heterodimeric cell cycle transcription factor e2f-dp

SCOP Domain Sequences for d1cf7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cf7a_ a.4.5.17 (A:) Cell cycle transcription factor E2F-4 {Human (Homo sapiens)}
srhekslgllttkfvsllqeakdgvldlklaadtlavrqkrriyditnvlegigliekks
knsiqwk

SCOP Domain Coordinates for d1cf7a_:

Click to download the PDB-style file with coordinates for d1cf7a_.
(The format of our PDB-style files is described here.)

Timeline for d1cf7a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cf7b_