SCOPe 2.01: Domain d2p47b_: 2p47 B:

Lineage for d2p47b_ (2p47 B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (11 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (16 PDB entries)

8. Domain d2p47b_: 2p47 B: [161502]
   Other proteins in same PDB: d2p47a_
   automated match to d1bzqk_
   protein/RNA complex

Details for d2p47b_

PDB Entry: 2p47, 2.5 Å

PDB Description: Complex of a camelid single-domain vhh antibody fragment with RNASE A at 2.5A resolution: SE5B-TRI crystal form with five se-met sites (L4M, M34, M51, F68M, M83) in vhh scaffold.

PDB Compounds: (B:) antibody cab-rn05

SCOPe Domain Sequences for d2p47b_:

Sequence; same for both SEQRES and ATOM records:

>d2p47b_ b.1.1.1 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqmvesggglvqaggslrlscaasgyaytyiymgwfrqapgkeregvaamdsggggtly
adsvkgrmtisrdkgkntvylqmdslkpedtatyycaaggyelrdrtygqwgqgtqvtvs
s

Timeline for d2p47b_:

• d2p47b_ is new in SCOPe 2.01-stable
  
• d2p47b_ appears in SCOPe 2.02
  
• d2p47b_ appears in the current release, SCOPe 2.08