Lineage for d1bby__ (1bby -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45282Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 45500Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (31 families) (S)
  5. 45637Family a.4.5.15: DNA-binding domain from rap30 [46841] (1 protein)
  6. 45638Protein DNA-binding domain from rap30 [46842] (1 species)
  7. 45639Species Human (Homo sapiens) [TaxId:9606] [46843] (2 PDB entries)
  8. 45641Domain d1bby__: 1bby - [16149]

Details for d1bby__

PDB Entry: 1bby (more details)

PDB Description: dna-binding domain from human rap30, nmr, minimized average

SCOP Domain Sequences for d1bby__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bby__ a.4.5.15 (-) DNA-binding domain from rap30 {Human (Homo sapiens)}
raradkqhvldmlfsafekhqyynlkdlvditkqpvvylkeilkeigvqnvkgihkntwe
lkpeyrhyq

SCOP Domain Coordinates for d1bby__:

Click to download the PDB-style file with coordinates for d1bby__.
(The format of our PDB-style files is described here.)

Timeline for d1bby__: