Lineage for d2j0mb_ (2j0m B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2543741Protein Focal adhesion kinase 1 (fak) [103292] (2 species)
    PTK group; FAK subfamily; non-membrane spanning protein tyrosine kinase
  7. 2543742Species Chicken (Gallus gallus) [TaxId:9031] [187336] (2 PDB entries)
  8. 2543744Domain d2j0mb_: 2j0m B: [161466]
    Other proteins in same PDB: d2j0ma1, d2j0ma2, d2j0ma3
    automated match to d1mp8a_
    complexed with 4st

Details for d2j0mb_

PDB Entry: 2j0m (more details), 2.8 Å

PDB Description: crystal structure a two-chain complex between the ferm and kinase domains of focal adhesion kinase.
PDB Compounds: (B:) Focal adhesion kinase 1

SCOPe Domain Sequences for d2j0mb_:

Sequence, based on SEQRES records: (download)

>d2j0mb_ d.144.1.7 (B:) Focal adhesion kinase 1 (fak) {Chicken (Gallus gallus) [TaxId: 9031]}
dyeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrekflqeal
tmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlsta
layleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklpikwmapes
infrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlys
lmtkcwaydpsrrprftelkaqlstileeeklq

Sequence, based on observed residues (ATOM records): (download)

>d2j0mb_ d.144.1.7 (B:) Focal adhesion kinase 1 (fak) {Chicken (Gallus gallus) [TaxId: 9031]}
dyeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrekflqeal
tmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlsta
layleskrfvhrdiaarnvlvssndcvklgdfgllpikwmapesinfrrftsasdvwmfg
vcmweilmhgvkpfqgvknndvigriengerlpmppncpptlyslmtkcwaydpsrrprf
telkaqlstileeeklq

SCOPe Domain Coordinates for d2j0mb_:

Click to download the PDB-style file with coordinates for d2j0mb_.
(The format of our PDB-style files is described here.)

Timeline for d2j0mb_: