Lineage for d2goxc_ (2gox C:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 920404Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 920721Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) (S)
  5. 920975Family a.102.4.4: Complement components [48251] (3 proteins)
    probably related to other families, but has no known enzymatic activity
  6. 920976Protein C3D, a C3 fragment and ligand for complement receptor 2 [48252] (2 species)
  7. 920977Species Human (Homo sapiens) [TaxId:9606] [48253] (8 PDB entries)
  8. 920983Domain d2goxc_: 2gox C: [161434]
    Other proteins in same PDB: d2goxb1, d2goxd_
    automated match to d1c3da_

Details for d2goxc_

PDB Entry: 2gox (more details), 2.2 Å

PDB Description: crystal structure of efb-c / c3d complex
PDB Compounds: (C:) Complement C3

SCOPe Domain Sequences for d2goxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2goxc_ a.102.4.4 (C:) C3D, a C3 fragment and ligand for complement receptor 2 {Human (Homo sapiens) [TaxId: 9606]}
gsrstdaerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelik
kgytqqlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlile
kqkpdgvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsit
kagdfleanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynv
eatsyallallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdap

SCOPe Domain Coordinates for d2goxc_:

Click to download the PDB-style file with coordinates for d2goxc_.
(The format of our PDB-style files is described here.)

Timeline for d2goxc_: