Lineage for d2bmed_ (2bme D:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 987698Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 988558Protein automated matches [190047] (13 species)
    not a true protein
  7. 988585Species Human (Homo sapiens) [TaxId:9606] [186768] (67 PDB entries)
  8. 988598Domain d2bmed_: 2bme D: [161395]
    automated match to d2bmda1
    complexed with bme, gnp, mg, trs

Details for d2bmed_

PDB Entry: 2bme (more details), 1.57 Å

PDB Description: high resolution structure of gppnhp-bound human rab4a
PDB Compounds: (D:) ras-related protein rab4a

SCOPe Domain Sequences for d2bmed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bmed_ c.37.1.8 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
setydflfkflvignagtgkscllhqfiekkfkddsnhtigvefgskiinvggkyvklqi
wdtagqerfrsvtrsyyrgaagallvyditsretynaltnwltdarmlasqniviilcgn
kkdldadrevtfleasrfaqenelmfletsaltgenveeafvqcarkilnkies

SCOPe Domain Coordinates for d2bmed_:

Click to download the PDB-style file with coordinates for d2bmed_.
(The format of our PDB-style files is described here.)

Timeline for d2bmed_: