Lineage for d2aq1e_ (2aq1 E:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 931683Protein automated matches [190119] (11 species)
    not a true protein
  7. 931803Species Mouse (Mus musculus) [TaxId:10090] [186842] (22 PDB entries)
  8. 931811Domain d2aq1e_: 2aq1 E: [161387]
    Other proteins in same PDB: d2aq1b1, d2aq1b2, d2aq1d1, d2aq1d2, d2aq1f1, d2aq1f2, d2aq1h1, d2aq1h2
    automated match to d2aq2a1
    mutant

Details for d2aq1e_

PDB Entry: 2aq1 (more details), 2.1 Å

PDB Description: crystal structure of t-cell receptor v beta domain variant complexed with superantigen sec3 mutant
PDB Compounds: (E:) T-cell receptor beta chain V

SCOPe Domain Sequences for d2aq1e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aq1e_ b.1.1.1 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygvgntekgdip
dgyeasrpsqeqfslilvsatpsqssvyfcasgvggtlyfgagtrlsvl

SCOPe Domain Coordinates for d2aq1e_:

Click to download the PDB-style file with coordinates for d2aq1e_.
(The format of our PDB-style files is described here.)

Timeline for d2aq1e_: