Lineage for d2fokb2 (2fok B:144-286)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1432Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (26 families) (S)
  5. 1519Family a.4.5.12: Restriction endonuclease FokI, N-terminal (recognition) domain [46824] (1 protein)
  6. 1520Protein Restriction endonuclease FokI, N-terminal (recognition) domain [46825] (1 species)
  7. 1521Species Flavobacterium okeanokoites [TaxId:244] [46826] (2 PDB entries)
  8. 1526Domain d2fokb2: 2fok B:144-286 [16135]
    Other proteins in same PDB: d2foka4, d2fokb4

Details for d2fokb2

PDB Entry: 2fok (more details), 2.3 Å

PDB Description: structure of restriction endonuclease foki

SCOP Domain Sequences for d2fokb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fokb2 a.4.5.12 (B:144-286) Restriction endonuclease FokI, N-terminal (recognition) domain {Flavobacterium okeanokoites}
gsaiekeilieaissyppairiltlledgqhltkfdlgknlgfsgesgftslpegilldt
lanampkdkgeirnnwegssdkyarmiggwldklglvkqgkkefiiptlgkpdnkefish
afkitgeglkvlrrakgstkftr

SCOP Domain Coordinates for d2fokb2:

Click to download the PDB-style file with coordinates for d2fokb2.
(The format of our PDB-style files is described here.)

Timeline for d2fokb2: