Lineage for d2foka1 (2fok A:5-143)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634918Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) (S)
    contains a small beta-sheet (wing)
  5. 635131Family a.4.5.12: Restriction endonuclease FokI, N-terminal (recognition) domain [46824] (1 protein)
  6. 635132Protein Restriction endonuclease FokI, N-terminal (recognition) domain [46825] (1 species)
    duplication: consists of three elaborated "winged helix" domains
  7. 635133Species Flavobacterium okeanokoites [TaxId:244] [46826] (2 PDB entries)
  8. 635134Domain d2foka1: 2fok A:5-143 [16131]
    Other proteins in same PDB: d2foka4, d2fokb4

Details for d2foka1

PDB Entry: 2fok (more details), 2.3 Å

PDB Description: structure of restriction endonuclease foki
PDB Compounds: (A:) foki restriction endonuclease

SCOP Domain Sequences for d2foka1:

Sequence, based on SEQRES records: (download)

>d2foka1 a.4.5.12 (A:5-143) Restriction endonuclease FokI, N-terminal (recognition) domain {Flavobacterium okeanokoites [TaxId: 244]}
irtfgwvqnpgkfenlkrvvqvfdrnskvhnevknikiptlvkeskiqkelvaimnqhdl
iytykelvgtgtsirseapcdaiiqatiadqgnkkgyidnwssdgflrwahalgfieyin
ksdsfvitdvglaysksad

Sequence, based on observed residues (ATOM records): (download)

>d2foka1 a.4.5.12 (A:5-143) Restriction endonuclease FokI, N-terminal (recognition) domain {Flavobacterium okeanokoites [TaxId: 244]}
irtfgwvqnpgkfenlkrvvqvfdrnskvhnevknikiptlvkeskiqkelvaimnqhdl
iytykelvgtgtapcdaiiqatiadqgkgyidnwssdgflrwahalgfieyinksdsfvi
tdvglaysksad

SCOP Domain Coordinates for d2foka1:

Click to download the PDB-style file with coordinates for d2foka1.
(The format of our PDB-style files is described here.)

Timeline for d2foka1: