SCOP 1.61: Domain d1hqcb1: 1hqc B:243-318

Lineage for d1hqcb1 (1hqc B:243-318)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (35 families)

5. Family a.4.5.11: Helicase DNA-binding domain [46819] (2 proteins)

6. Protein Holliday junction helicase RuvB [46820] (2 species)

7. Species Thermus thermophilus [TaxId:274] [46821] (1 PDB entry)

8. Domain d1hqcb1: 1hqc B:243-318 [16128]
   Other proteins in same PDB: d1hqca2, d1hqcb2

Details for d1hqcb1

PDB Entry: 1hqc, 3.2 Å

PDB Description: structure of ruvb from thermus thermophilus hb8

SCOP Domain Sequences for d1hqcb1:

Sequence; same for both SEQRES and ATOM records:

>d1hqcb1 a.4.5.11 (B:243-318) Holliday junction helicase RuvB {Thermus thermophilus}
lglekrdreilevlilrfgggpvglatlatalsedpgtleevhepylirqgllkrtprgr
vptelayrhlgypppv

Timeline for d1hqcb1:

• d1hqcb1 first appeared (with stable ids) in SCOP 1.55
  
• d1hqcb1 appears in SCOP 1.59
  
• d1hqcb1 appears in SCOP 1.63
  
• d1hqcb1 appears in the current release, SCOPe 2.08