SCOP 1.59: Domain d1bm9b_: 1bm9 B:

Lineage for d1bm9b_ (1bm9 B:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (32 families)

5. Family a.4.5.7: Replication terminator protein (RTP) [46807] (1 protein)

6. Protein Replication terminator protein (RTP) [46808] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [46809] (2 PDB entries)

8. Domain d1bm9b_: 1bm9 B: [16117]

Details for d1bm9b_

PDB Entry: 1bm9, 2 Å

PDB Description: replication terminator protein from bacillus subtilis

SCOP Domain Sequences for d1bm9b_:

Sequence; same for both SEQRES and ATOM records:

>d1bm9b_ a.4.5.7 (B:) Replication terminator protein (RTP) {Bacillus subtilis}
eekrsstgflvkqraflklymitmteqerlyglkllevlrsefkeigfkpnhtevyrslh
ellddgilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrckkliekalsdnf

Timeline for d1bm9b_:

• d1bm9b_ first appeared (with stable ids) in SCOP 1.55
  
• d1bm9b_ appears in SCOP 1.57
  
• d1bm9b_ appears in SCOP 1.61
  
• d1bm9b_ appears in the current release, SCOPe 2.08