Lineage for d1bm9a_ (1bm9 A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761866Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) (S)
    contains a small beta-sheet (wing)
  5. 762040Family a.4.5.7: Replication terminator protein (RTP) [46807] (1 protein)
  6. 762041Protein Replication terminator protein (RTP) [46808] (1 species)
    contains long helix in the C-terminal extension; forms dimer similar to the LysR-like dimer
  7. 762042Species Bacillus subtilis [TaxId:1423] [46809] (6 PDB entries)
  8. 762043Domain d1bm9a_: 1bm9 A: [16116]
    CASP1

Details for d1bm9a_

PDB Entry: 1bm9 (more details), 2 Å

PDB Description: replication terminator protein from bacillus subtilis
PDB Compounds: (A:) replication terminator protein

SCOP Domain Sequences for d1bm9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bm9a_ a.4.5.7 (A:) Replication terminator protein (RTP) {Bacillus subtilis [TaxId: 1423]}
eekrsstgflvkqraflklymitmteqerlyglkllevlrsefkeigfkpnhtevyrslh
ellddgilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrckkliekalsdnf

SCOP Domain Coordinates for d1bm9a_:

Click to download the PDB-style file with coordinates for d1bm9a_.
(The format of our PDB-style files is described here.)

Timeline for d1bm9a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bm9b_