Lineage for d1berb1 (1ber B:138-205)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94900Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 95173Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (32 families) (S)
  5. 95206Family a.4.5.4: CAP C-terminal domain-like [46796] (2 proteins)
  6. 95207Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species)
  7. 95208Species Escherichia coli [TaxId:562] [46798] (11 PDB entries)
  8. 95217Domain d1berb1: 1ber B:138-205 [16095]
    Other proteins in same PDB: d1bera2, d1berb2

Details for d1berb1

PDB Entry: 1ber (more details), 2.5 Å

PDB Description: structure of the cap-dna complex at 2.5 angstroms resolution: a complete picture of the protein-dna interface

SCOP Domain Sequences for d1berb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1berb1 a.4.5.4 (B:138-205) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivv

SCOP Domain Coordinates for d1berb1:

Click to download the PDB-style file with coordinates for d1berb1.
(The format of our PDB-style files is described here.)

Timeline for d1berb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1berb2