Lineage for d1bera1 (1ber A:138-207)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1432Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (26 families) (S)
  5. 1454Family a.4.5.4: CAP C-terminal domain-like [46796] (2 proteins)
  6. 1455Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species)
  7. 1456Species Escherichia coli [TaxId:562] [46798] (7 PDB entries)
  8. 1462Domain d1bera1: 1ber A:138-207 [16094]
    Other proteins in same PDB: d1bera2, d1berb2

Details for d1bera1

PDB Entry: 1ber (more details), 2.5 Å

PDB Description: structure of the cap-dna complex at 2.5 angstroms resolution: a complete picture of the protein-dna interface

SCOP Domain Sequences for d1bera1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bera1 a.4.5.4 (A:138-207) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvyg

SCOP Domain Coordinates for d1bera1:

Click to download the PDB-style file with coordinates for d1bera1.
(The format of our PDB-style files is described here.)

Timeline for d1bera1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bera2