Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.3: Arginine repressor (ArgR), N-terminal DNA-binding domain [46792] (1 protein) automatically mapped to Pfam PF01316 |
Protein Arginine repressor (ArgR), N-terminal DNA-binding domain [46793] (3 species) |
Species Bacillus stearothermophilus [TaxId:1422] [46795] (1 PDB entry) |
Domain d1b4ad1: 1b4a D:4-78 [16091] Other proteins in same PDB: d1b4aa2, d1b4ab2, d1b4ac2, d1b4ad2, d1b4ae2, d1b4af2 |
PDB Entry: 1b4a (more details), 2.5 Å
SCOPe Domain Sequences for d1b4ad1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b4ad1 a.4.5.3 (D:4-78) Arginine repressor (ArgR), N-terminal DNA-binding domain {Bacillus stearothermophilus [TaxId: 1422]} gqrhikireiimsndietqdelvdrlreagfnvtqatvsrdikemqlvkvpmangrykys lpsdqrfnplqklkr
Timeline for d1b4ad1: