Lineage for d1b4aa1 (1b4a A:4-78)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634918Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) (S)
    contains a small beta-sheet (wing)
  5. 634938Family a.4.5.3: Arginine repressor (ArgR), N-terminal DNA-binding domain [46792] (1 protein)
  6. 634939Protein Arginine repressor (ArgR), N-terminal DNA-binding domain [46793] (3 species)
  7. 634940Species Bacillus stearothermophilus [TaxId:1422] [46795] (1 PDB entry)
  8. 634941Domain d1b4aa1: 1b4a A:4-78 [16088]
    Other proteins in same PDB: d1b4aa2, d1b4ab2, d1b4ac2, d1b4ad2, d1b4ae2, d1b4af2

Details for d1b4aa1

PDB Entry: 1b4a (more details), 2.5 Å

PDB Description: structure of the arginine repressor from bacillus stearothermophilus
PDB Compounds: (A:) Arginine repressor

SCOP Domain Sequences for d1b4aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b4aa1 a.4.5.3 (A:4-78) Arginine repressor (ArgR), N-terminal DNA-binding domain {Bacillus stearothermophilus [TaxId: 1422]}
gqrhikireiimsndietqdelvdrlreagfnvtqatvsrdikemqlvkvpmangrykys
lpsdqrfnplqklkr

SCOP Domain Coordinates for d1b4aa1:

Click to download the PDB-style file with coordinates for d1b4aa1.
(The format of our PDB-style files is described here.)

Timeline for d1b4aa1: