Lineage for d1aoya_ (1aoy A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 906051Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 906071Family a.4.5.3: Arginine repressor (ArgR), N-terminal DNA-binding domain [46792] (1 protein)
  6. 906072Protein Arginine repressor (ArgR), N-terminal DNA-binding domain [46793] (3 species)
  7. 906092Species Escherichia coli [TaxId:562] [46794] (1 PDB entry)
  8. 906093Domain d1aoya_: 1aoy A: [16087]

Details for d1aoya_

PDB Entry: 1aoy (more details)

PDB Description: n-terminal domain of escherichia coli arginine repressor nmr, 23 structures
PDB Compounds: (A:) Arginine repressor

SCOPe Domain Sequences for d1aoya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aoya_ a.4.5.3 (A:) Arginine repressor (ArgR), N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]}
mrssakqeelvkafkallkeekfssqgeivaalqeqgfdninqskvsrmltkfgavrtrn
akmemvyclpaelgvptt

SCOPe Domain Coordinates for d1aoya_:

Click to download the PDB-style file with coordinates for d1aoya_.
(The format of our PDB-style files is described here.)

Timeline for d1aoya_: