Lineage for d1qnta1 (1qnt A:92-176)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies) 
Superfamily a.4.2: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46767] (1 family) 
Family a.4.2.1: Methylated DNA-protein cysteine methyltransferase, C-terminal domain [46768] (2 proteins) Protein O6-alkylguanine-DNA alkyltransferase [46771] (2 species) Species Human (Homo sapiens) [TaxId:9606] [46772] (4 PDB entries) 
Domain d1qnta1: 1qnt A:92-176 [16074]
Other proteins in same PDB: d1qnta2
Details for d1qnta1
PDB Entry: 1qnt (more details), 1.9 Å
PDB Description: x-ray structure of human o6alkylguanine-dna alkyltransferase
SCOP Domain Sequences for d1qnta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qnta1 a.4.2.1 (A:92-176) O6-alkylguanine-DNA alkyltransferase {Human (Homo sapiens)}
esftrqvlwkllkvvkfgevisyqqlaalagnpkaaravggamrgnpvpilipchrvvcs
sgavgnysgglavkewllaheghrl
SCOP Domain Coordinates for d1qnta1:
Click to download the PDB-style file with coordinates for d1qnta1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qnta1:
- d1qnta1 appears in SCOP 1.57
- d1qnta1 appears in the current release, SCOPe 2.08
View in 3D
