Lineage for d1qpia1 (1qpi A:4-67)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981564Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1981994Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 1982219Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species)
  7. 1982220Species Escherichia coli [TaxId:562] [46766] (27 PDB entries)
  8. 1982249Domain d1qpia1: 1qpi A:4-67 [16072]
    Other proteins in same PDB: d1qpia2
    protein/DNA complex; complexed with imd

Details for d1qpia1

PDB Entry: 1qpi (more details), 2.5 Å

PDB Description: crystal structure of tetracycline repressor/operator complex
PDB Compounds: (A:) protein (tetracycline repressor)

SCOPe Domain Sequences for d1qpia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qpia1 a.4.1.9 (A:4-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
lnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveilarh
hdys

SCOPe Domain Coordinates for d1qpia1:

Click to download the PDB-style file with coordinates for d1qpia1.
(The format of our PDB-style files is described here.)

Timeline for d1qpia1: