Lineage for d1qpia1 (1qpi A:4-67)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies) 
Superfamily a.4.1: Homeodomain-like [46689] (9 families) 
Family a.4.1.9: Tetracyclin repressor (Tet-repressor, TetR), N-terminal domain [46764] (1 protein) Protein Tetracyclin repressor (Tet-repressor, TetR), N-terminal domain [46765] (1 species) Species Escherichia coli [TaxId:562] [46766] (9 PDB entries) 
Domain d1qpia1: 1qpi A:4-67 [16072]
Other proteins in same PDB: d1qpia2
Details for d1qpia1
PDB Entry: 1qpi (more details), 2.5 Å
PDB Description: crystal structure of tetracycline repressor/operator complex
SCOP Domain Sequences for d1qpia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qpia1 a.4.1.9 (A:4-67) Tetracyclin repressor (Tet-repressor, TetR), N-terminal domain {Escherichia coli}
lnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveilarh
hdys
SCOP Domain Coordinates for d1qpia1:
Click to download the PDB-style file with coordinates for d1qpia1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qpia1:
- d1qpia1 appears in SCOP 1.57
- d1qpia1 appears in the current release, SCOPe 2.08
View in 3D
