Lineage for d1bjza1 (1bjz A:2-67)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1477566Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1477968Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 1478159Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species)
  7. 1478160Species Escherichia coli [TaxId:562] [46766] (26 PDB entries)
  8. 1478177Domain d1bjza1: 1bjz A:2-67 [16065]
    Other proteins in same PDB: d1bjza2

Details for d1bjza1

PDB Entry: 1bjz (more details), 2.2 Å

PDB Description: tetracycline chelated mg2+-ion initiates helix unwinding for tet repressor induction
PDB Compounds: (A:) tetracycline repressor

SCOPe Domain Sequences for d1bjza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bjza1 a.4.1.9 (A:2-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
rhhdys

SCOPe Domain Coordinates for d1bjza1:

Click to download the PDB-style file with coordinates for d1bjza1.
(The format of our PDB-style files is described here.)

Timeline for d1bjza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bjza2