Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.8: AraC type transcriptional activator [46759] (2 proteins) duplication: consists of two structural repeats bipartite HTH protein |
Protein Rob transcription factor, N-terminal domain [46762] (1 species) |
Species Escherichia coli [TaxId:562] [46763] (1 PDB entry) |
Domain d1d5yd2: 1d5y D:57-121 [16062] Other proteins in same PDB: d1d5ya3, d1d5ya4, d1d5yb3, d1d5yb4, d1d5yc3, d1d5yc4, d1d5yd3, d1d5yd4 protein/DNA complex |
PDB Entry: 1d5y (more details), 2.7 Å
SCOPe Domain Sequences for d1d5yd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d5yd2 a.4.1.8 (D:57-121) Rob transcription factor, N-terminal domain {Escherichia coli [TaxId: 562]} rrlsksavalrltarpildialqyrfdsqqtftrafkkqfaqtpalyrrspewsafgirp plrlg
Timeline for d1d5yd2: