Lineage for d1d5yc1 (1d5y C:3-56)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2305638Family a.4.1.8: AraC type transcriptional activator [46759] (2 proteins)
    duplication: consists of two structural repeats bipartite HTH protein
  6. 2305643Protein Rob transcription factor, N-terminal domain [46762] (1 species)
  7. 2305644Species Escherichia coli [TaxId:562] [46763] (1 PDB entry)
  8. 2305649Domain d1d5yc1: 1d5y C:3-56 [16059]
    Other proteins in same PDB: d1d5ya3, d1d5ya4, d1d5yb3, d1d5yb4, d1d5yc3, d1d5yc4, d1d5yd3, d1d5yd4
    protein/DNA complex

Details for d1d5yc1

PDB Entry: 1d5y (more details), 2.7 Å

PDB Description: crystal structure of the e. coli rob transcription factor in complex with dna
PDB Compounds: (C:) rob transcription factor

SCOPe Domain Sequences for d1d5yc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5yc1 a.4.1.8 (C:3-56) Rob transcription factor, N-terminal domain {Escherichia coli [TaxId: 562]}
qagiirdlliwleghldqplsldnvaakagyskwhlqrmfkdvtghaigayira

SCOPe Domain Coordinates for d1d5yc1:

Click to download the PDB-style file with coordinates for d1d5yc1.
(The format of our PDB-style files is described here.)

Timeline for d1d5yc1: