Lineage for d1bl0a2 (1bl0 A:63-124)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692195Family a.4.1.8: AraC type transcriptional activator [46759] (2 proteins)
    duplication: consists of two structural repeats bipartite HTH protein
  6. 2692196Protein MarA [46760] (1 species)
  7. 2692197Species Escherichia coli [TaxId:562] [46761] (1 PDB entry)
  8. 2692199Domain d1bl0a2: 1bl0 A:63-124 [16054]
    CASP3
    protein/DNA complex

Details for d1bl0a2

PDB Entry: 1bl0 (more details), 2.3 Å

PDB Description: multiple antibiotic resistance protein (mara)/dna complex
PDB Compounds: (A:) protein (multiple antibiotic resistance protein)

SCOPe Domain Sequences for d1bl0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bl0a2 a.4.1.8 (A:63-124) MarA {Escherichia coli [TaxId: 562]}
rkmteiaqklkesnepilylaerygfesqqtltrtfknyfdvpphkyrmtnmqgesrflh
pl

SCOPe Domain Coordinates for d1bl0a2:

Click to download the PDB-style file with coordinates for d1bl0a2.
(The format of our PDB-style files is described here.)

Timeline for d1bl0a2: