![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.8: AraC type transcriptional activator [46759] (2 proteins) duplication: consists of two structural repeats bipartite HTH protein |
![]() | Protein MarA [46760] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [46761] (1 PDB entry) |
![]() | Domain d1bl0a2: 1bl0 A:63-124 [16054] CASP3 protein/DNA complex |
PDB Entry: 1bl0 (more details), 2.3 Å
SCOPe Domain Sequences for d1bl0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bl0a2 a.4.1.8 (A:63-124) MarA {Escherichia coli [TaxId: 562]} rkmteiaqklkesnepilylaerygfesqqtltrtfknyfdvpphkyrmtnmqgesrflh pl
Timeline for d1bl0a2: