SCOPe 2.06: Domain d1ignb2: 1ign B:446-594

Lineage for d1ignb2 (1ign B:446-594)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.6: DNA-binding domain of rap1 [46753] (2 proteins)
   duplication: consist of two domains of this fold

6. Protein DNA-binding domain of rap1 [46754] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46755] (1 PDB entry)

8. Domain d1ignb2: 1ign B:446-594 [16051]
   protein/DNA complex

Details for d1ignb2

PDB Entry: 1ign, 2.25 Å

PDB Description: dna-binding domain of rap1 in complex with telomeric dna site

PDB Compounds: (B:) protein (rap1)

SCOPe Domain Sequences for d1ignb2:

Sequence, based on SEQRES records:

>d1ignb2 a.4.1.6 (B:446-594) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
krkfsadedytlaiavkkqfyrdlfqidpdtgrslitdedtptaiarrnmtmdpnhvpgs
epnfaayrtqsrrgpiareffkhfaeehaahtenawrdrfrkfllaygiddyisyyeaek
aqnrepepmknltnrpkrpgvptpgnyns

Sequence, based on observed residues (ATOM records):

>d1ignb2 a.4.1.6 (B:446-594) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
krkfsadedytlaiavkkqfyrdlfqidpdtgrslirtqsrrgpiareffkhfaeehaah
tenawrdrfrkfllaygiddyisyyeaeepmknltptpgnyns

Timeline for d1ignb2:

• d1ignb2 first appeared (with stable ids) in SCOP 1.55
  
• d1ignb2 appears in SCOPe 2.05
  
• d1ignb2 appears in SCOPe 2.07
  
• d1ignb2 appears in the current release, SCOPe 2.08