Lineage for d6paxa_ (6pax A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1224Superfamily a.4.1: Homeodomain-like [46689] (9 families) (S)
  5. 1358Family a.4.1.5: Paired domain [46748] (2 proteins)
  6. 1362Protein Pax-6 [46749] (1 species)
  7. 1363Species Human (Homo sapiens) [TaxId:9606] [46750] (1 PDB entry)
  8. 1364Domain d6paxa_: 6pax A: [16046]

Details for d6paxa_

PDB Entry: 6pax (more details), 2.5 Å

PDB Description: crystal structure of the human pax-6 paired domain-dna complex reveals a general model for pax protein-dna interactions

SCOP Domain Sequences for d6paxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6paxa_ a.4.1.5 (A:) Pax-6 {Human (Homo sapiens)}
shsgvnqlggvfvngrplpdstrqrivelahsgarpcdisrilqvsngcvskilgryyat
gsirpraiggskprvatpevvskiaqykqecpsifaweirdrllsegvctndnipsvssi
nrvlrnlasekqq

SCOP Domain Coordinates for d6paxa_:

Click to download the PDB-style file with coordinates for d6paxa_.
(The format of our PDB-style files is described here.)

Timeline for d6paxa_: