SCOP 1.63: Domain d1msec1: 1mse C:89-143

Lineage for d1msec1 (1mse C:89-143)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (11 families)
   consists only of helices

5. Family a.4.1.3: Myb [46739] (4 proteins)

6. Protein c-Myb, DNA-binding domain [46740] (2 species)
   duplication

7. Species Mouse (Mus musculus) [TaxId:10090] [46742] (12 PDB entries)

8. Domain d1msec1: 1mse C:89-143 [16039]

Details for d1msec1

PDB Entry: 1mse

PDB Description: solution structure of a specific dna complex of the myb dna-binding domain with cooperative recognition helices

SCOP Domain Sequences for d1msec1:

Sequence; same for both SEQRES and ATOM records:

>d1msec1 a.4.1.3 (C:89-143) c-Myb, DNA-binding domain {Mouse (Mus musculus)}
mlikgpwtkeedqrviklvqkygpkrwsviakhlkgrigkqcrerwhnhlnpevk

Timeline for d1msec1:

• d1msec1 first appeared (with stable ids) in SCOP 1.55
  
• d1msec1 appears in SCOP 1.61
  
• d1msec1 appears in SCOP 1.65
  
• d1msec1 appears in the current release, SCOPe 2.08