Lineage for d1mbja_ (1mbj A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634287Superfamily a.4.1: Homeodomain-like [46689] (17 families) (S)
    consists only of helices
  5. 634507Family a.4.1.3: Myb/SANT domain [46739] (13 proteins)
  6. 634515Protein c-Myb, DNA-binding domain [46740] (1 species)
    duplication
  7. 634516Species Mouse (Mus musculus) [TaxId:10090] [46742] (16 PDB entries)
  8. 634531Domain d1mbja_: 1mbj A: [16035]
    repeat 3
    complexed with nh2

Details for d1mbja_

PDB Entry: 1mbj (more details)

PDB Description: mouse c-myb dna-binding domain repeat 3
PDB Compounds: (A:) Myb proto-oncogene protein

SCOP Domain Sequences for d1mbja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mbja_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]}
vkktswteeedriiyqahkrlgnrwaeiakllpgrtdnaiknhwnstmrrkv

SCOP Domain Coordinates for d1mbja_:

Click to download the PDB-style file with coordinates for d1mbja_.
(The format of our PDB-style files is described here.)

Timeline for d1mbja_: