SCOPe 2.08: Domain d1qrya1: 1qry A:5-80

Lineage for d1qrya1 (1qry A:5-80)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein VND/NK-2 protein [46724] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46725] (4 PDB entries)

8. Domain d1qrya1: 1qry A:5-80 [16016]
   Other proteins in same PDB: d1qrya2

Details for d1qrya1

PDB Entry: 1qry

PDB Description: homeobox protein vnd (ventral nervous system defective protein)

PDB Compounds: (A:) protein (homeobox ventral nervous system defective protein)

SCOPe Domain Sequences for d1qrya1:

Sequence; same for both SEQRES and ATOM records:

>d1qrya1 a.4.1.1 (A:5-80) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
sdglpnkkrkrrvlftkaqtyelerrfrqqrylsaperehltslirltptqvkiwfqnhr
yktkraqnekgyeghp

Timeline for d1qrya1:

• d1qrya1 first appeared (with stable ids) in SCOP 1.55, called d1qrya_
  
• d1qrya1 was called d1qrya_ in SCOPe 2.07