SCOPe 2.07: Domain d1ahdp1: 1ahd P:1-67

Lineage for d1ahdp1 (1ahd P:1-67)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein Antennapedia Homeodomain [46716] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46717] (5 PDB entries)

8. Domain d1ahdp1: 1ahd P:1-67 [16006]
   Other proteins in same PDB: d1ahdp2
   protein/DNA complex

Details for d1ahdp1

PDB Entry: 1ahd

PDB Description: determination of the nmr solution structure of an antennapedia homeodomain-dna complex

PDB Compounds: (P:) Homeotic protein antennapedia

SCOPe Domain Sequences for d1ahdp1:

Sequence; same for both SEQRES and ATOM records:

>d1ahdp1 a.4.1.1 (P:1-67) Antennapedia Homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rkrgrqtytryqtlelekefhfnryltrrrrieiahalslterqikiwfqnrrmkwkken
ktkgepg

Timeline for d1ahdp1:

• d1ahdp1 first appeared (with stable ids) in SCOP 1.55, called d1ahdp_
  
• d1ahdp1 was called d1ahdp_ in SCOPe 2.06
  
• d1ahdp1 appears in the current release, SCOPe 2.08