SCOP 1.69: Domain d1bw5__: 1bw5 -

Lineage for d1bw5__ (1bw5 -)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (13 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (23 proteins)

6. Protein Insulin gene enhancer protein isl-1 [46714] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [46715] (1 PDB entry)

8. Domain d1bw5__: 1bw5 - [16003]

Details for d1bw5__

PDB Entry: 1bw5

PDB Description: the nmr solution structure of the homeodomain of the rat insulin gene enhancer protein isl-1, 50 structures

SCOP Domain Sequences for d1bw5__:

Sequence; same for both SEQRES and ATOM records:

>d1bw5__ a.4.1.1 (-) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus)}
mkttrvrtvlnekqlhtlrtcyaanprpdalmkeqlvemtglsprvirvwfqnkrckdkk
rsimmk

Timeline for d1bw5__:

• d1bw5__ first appeared (with stable ids) in SCOP 1.55
  
• d1bw5__ appears in SCOP 1.67
  
• d1bw5__ appears in SCOP 1.71
  
• d1bw5__ appears in the current release, SCOPe 2.08, called d1bw5a_