Class a: All alpha proteins [46456] (218 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (13 families) consists only of helices |
Family a.4.1.1: Homeodomain [46690] (23 proteins) |
Protein Oct-1 POU Homeodomain [46699] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [46700] (7 PDB entries) |
Domain d1pog__: 1pog - [15994] |
PDB Entry: 1pog (more details)
SCOP Domain Sequences for d1pog__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pog__ a.4.1.1 (-) Oct-1 POU Homeodomain {Human (Homo sapiens)} rrrkkrtsietnirvaleksflenqkptseeitmiadqlnmekevirvwfcnrrqkekri di
Timeline for d1pog__: