Lineage for d1lfb__ (1lfb -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies) 
Superfamily a.4.1: Homeodomain-like [46689] (9 families) 
Family a.4.1.1: Homeodomain [46690] (18 proteins) 
Protein Transcription factor LFB1 [46697] (1 species) Species Rat (Rattus rattus) [TaxId:10117] [46698] (2 PDB entries) 
Domain d1lfb__: 1lfb - [15989]
Details for d1lfb__
PDB Entry: 1lfb (more details), 2.8 Å
PDB Description: the x-ray structure of an atypical homeodomain present in the rat liver transcription factor lfb1(slash)hnf1 and implications for dna binding
SCOP Domain Sequences for d1lfb__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lfb__ a.4.1.1 (-) Transcription factor LFB1 {Rat (Rattus rattus)}
rfkwgpasqqilfqayerqknpskeeretlveecnraeciqrgvspsqaqglgsnlvtev
rvynwfanrrkeeafrhk
SCOP Domain Coordinates for d1lfb__:
Click to download the PDB-style file with coordinates for d1lfb__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lfb__:
- d1lfb__ appears in SCOP 1.57
- d1lfb__ appears in the current release, SCOPe 2.08, called d1lfba_
View in 3D