SCOP 1.75: Domain d1apld_: 1apl D:

Lineage for d1apld_ (1apl D:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (19 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (40 proteins)
   Pfam PF00046

6. Protein mat alpha2 Homeodomain [46695] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46696] (6 PDB entries)

8. Domain d1apld_: 1apl D: [15988]
   protein/DNA complex

Details for d1apld_

PDB Entry: 1apl, 2.7 Å

PDB Description: crystal structure of a mat-alpha2 homeodomain-operator complex suggests a general model for homeodomain-dna interactions

PDB Compounds: (D:) protein (mat-alpha2 homeodomain)

SCOP Domain Sequences for d1apld_:

Sequence; same for both SEQRES and ATOM records:

>d1apld_ a.4.1.1 (D:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rghrftkenvrileswfaknienpyldtkglenlmkntslsriqiknwvsnrrrkekt

Timeline for d1apld_:

• d1apld_ first appeared (with stable ids) in SCOP 1.55
  
• d1apld_ appears in SCOP 1.73
  
• d1apld_ appears in SCOPe 2.01
  
• d1apld_ appears in the current release, SCOPe 2.08