SCOPe 2.03: Domain d3bccd2: 3bcc D:1-195

Lineage for d3bccd2 (3bcc D:1-195)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)

6. Protein Cytochrome bc1 domain [46677] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [46679] (3 PDB entries)

8. Domain d3bccd2: 3bcc D:1-195 [15961]
   Other proteins in same PDB: d3bcca1, d3bcca2, d3bccb1, d3bccb2, d3bccc2, d3bccc3, d3bccd3, d3bcce1, d3bcce2, d3bccf_, d3bccg_, d3bcch_, d3bccj_
   complexed with amy, fes, hem, sig

Details for d3bccd2

PDB Entry: 3bcc, 3.7 Å

PDB Description: stigmatellin and antimycin bound cytochrome bc1 complex from chicken

PDB Compounds: (D:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d3bccd2:

Sequence; same for both SEQRES and ATOM records:

>d3bccd2 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Chicken (Gallus gallus) [TaxId: 9031]}
sdlelhppsypwshrgplssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvsvreglyfnpyfpgqaigmappiyndvlefddgtpatms
qvakdvctflrwaae

Timeline for d3bccd2:

• d3bccd2 first appeared (with stable ids) in SCOP 1.55
  
• d3bccd2 appears in SCOPe 2.02
  
• d3bccd2 appears in SCOPe 2.04
  
• d3bccd2 appears in the current release, SCOPe 2.08