Lineage for d2bccd2 (2bcc D:1-195)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257168Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1257169Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1257611Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)
  6. 1257612Protein Cytochrome bc1 domain [46677] (3 species)
  7. 1257624Species Chicken (Gallus gallus) [TaxId:9031] [46679] (3 PDB entries)
  8. 1257626Domain d2bccd2: 2bcc D:1-195 [15960]
    Other proteins in same PDB: d2bcca1, d2bcca2, d2bccb1, d2bccb2, d2bccc2, d2bccc3, d2bccd3, d2bcce1, d2bcce2, d2bccf_, d2bccg_, d2bcch_, d2bccj_
    complexed with bog, fes, hem, pee, sig, u10

Details for d2bccd2

PDB Entry: 2bcc (more details), 3.5 Å

PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken
PDB Compounds: (D:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d2bccd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bccd2 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Chicken (Gallus gallus) [TaxId: 9031]}
sdlelhppsypwshrgplssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvsvreglyfnpyfpgqaigmappiyndvlefddgtpatms
qvakdvctflrwaae

SCOPe Domain Coordinates for d2bccd2:

Click to download the PDB-style file with coordinates for d2bccd2.
(The format of our PDB-style files is described here.)

Timeline for d2bccd2: