Lineage for d2bccd2 (2bcc D:1-195)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 985Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 986Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 1195Family a.3.1.3: Cytochrome bc1 domain [46676] (1 protein)
  6. 1196Protein Cytochrome bc1 domain [46677] (2 species)
  7. 1197Species Chicken (Gallus gallus) [TaxId:9031] [46679] (3 PDB entries)
  8. 1199Domain d2bccd2: 2bcc D:1-195 [15960]
    Other proteins in same PDB: d2bcca_, d2bccb_, d2bccc1, d2bccd3, d2bcce1, d2bcce2, d2bccf1, d2bccg1, d2bcch1, d2bccj1

Details for d2bccd2

PDB Entry: 2bcc (more details), 3.5 Å

PDB Description: stigmatellin-bound cytochrome bc1 complex from chicken

SCOP Domain Sequences for d2bccd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bccd2 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Chicken (Gallus gallus)}
sdlelhppsypwshrgplssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvsvreglyfnpyfpgqaigmappiyndvlefddgtpatms
qvakdvctflrwaae

SCOP Domain Coordinates for d2bccd2:

Click to download the PDB-style file with coordinates for d2bccd2.
(The format of our PDB-style files is described here.)

Timeline for d2bccd2: