Lineage for d1bgyp2 (1bgy P:1-195)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 985Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 986Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 1195Family a.3.1.3: Cytochrome bc1 domain [46676] (1 protein)
  6. 1196Protein Cytochrome bc1 domain [46677] (2 species)
  7. 1201Species Cow (Bos taurus) [TaxId:9913] [46678] (3 PDB entries)
  8. 1205Domain d1bgyp2: 1bgy P:1-195 [15958]
    Other proteins in same PDB: d1bgya_, d1bgyb_, d1bgyc1, d1bgyd3, d1bgye1, d1bgyf1, d1bgyg1, d1bgyh1, d1bgyj1, d1bgyk1, d1bgym_, d1bgyn_, d1bgyo1, d1bgyp3, d1bgyq1, d1bgyq2, d1bgyr1, d1bgys1, d1bgyt1, d1bgyv1, d1bgyw1

Details for d1bgyp2

PDB Entry: 1bgy (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine

SCOP Domain Sequences for d1bgyp2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgyp2 a.3.1.3 (P:1-195) Cytochrome bc1 domain {Cow (Bos taurus)}
sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
qvakdvctflrwaae

SCOP Domain Coordinates for d1bgyp2:

Click to download the PDB-style file with coordinates for d1bgyp2.
(The format of our PDB-style files is described here.)

Timeline for d1bgyp2: