Lineage for d1bgyd2 (1bgy D:1-195)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149460Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 149461Superfamily a.3.1: Cytochrome c [46626] (7 families) (S)
  5. 149734Family a.3.1.3: Cytochrome bc1 domain [46676] (1 protein)
  6. 149735Protein Cytochrome bc1 domain [46677] (3 species)
  7. 149744Species Cow (Bos taurus) [TaxId:9913] [46678] (3 PDB entries)
  8. 149747Domain d1bgyd2: 1bgy D:1-195 [15957]
    Other proteins in same PDB: d1bgya1, d1bgya2, d1bgyb1, d1bgyb2, d1bgyc1, d1bgyd3, d1bgye1, d1bgyf1, d1bgyg1, d1bgyh1, d1bgyj1, d1bgyk1, d1bgym1, d1bgym2, d1bgyn1, d1bgyn2, d1bgyo1, d1bgyp3, d1bgyq1, d1bgyq2, d1bgyr1, d1bgys1, d1bgyt1, d1bgyv1, d1bgyw1

Details for d1bgyd2

PDB Entry: 1bgy (more details), 3 Å

PDB Description: cytochrome bc1 complex from bovine

SCOP Domain Sequences for d1bgyd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgyd2 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Cow (Bos taurus)}
sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
qvakdvctflrwaae

SCOP Domain Coordinates for d1bgyd2:

Click to download the PDB-style file with coordinates for d1bgyd2.
(The format of our PDB-style files is described here.)

Timeline for d1bgyd2: