![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (8 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein) |
![]() | Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species) the C-terminal domain is a 8-bladed beta-propeller |
![]() | Species Paracoccus pantotrophus [TaxId:82367] [46673] (11 PDB entries) formerly Thiosphaera pantotropha |
![]() | Domain d1hj3a1: 1hj3 A:17-133 [15930] Other proteins in same PDB: d1hj3a2, d1hj3b2 |
PDB Entry: 1hj3 (more details), 1.6 Å
SCOP Domain Sequences for d1hj3a1:
Sequence, based on SEQRES records: (download)
>d1hj3a1 a.3.1.2 (A:17-133) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Paracoccus pantotrophus [TaxId: 82367]} hktrtdnryepsldnlaqqdvaapgapegvsalsdaqyneankiyfercagchgvlrkga tgkaltpdltrdlgfdylqsfitygspagmpnwgtsgelsaeqvdlmanyllldpaa
>d1hj3a1 a.3.1.2 (A:17-133) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Paracoccus pantotrophus [TaxId: 82367]} hktrtdnryepsldnlaqqdvaapgapegvsalsdaqyneankiyfercagchgvlrkga tgkaltpdltrdlgfdylqsfitygspagmplsaeqvdlmanyllldpaa
Timeline for d1hj3a1: