SCOPe 2.08: Domain d1diic_: 1dii C:

Lineage for d1diic_ (1dii C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein p-Cresol methylhydroxylase, cytochrome c subunit [46669] (1 species)
   the other subunit is a flavoprotein

7. Species Pseudomonas putida [TaxId:303] [46670] (2 PDB entries)

8. Domain d1diic_: 1dii C: [15925]
   Other proteins in same PDB: d1diia1, d1diia2, d1diib1, d1diib2
   complexed with cl, fad, hec

Details for d1diic_

PDB Entry: 1dii, 2.5 Å

PDB Description: crystal structure of p-cresol methylhydroxylase at 2.5 a resolution

PDB Compounds: (C:) p-cresol methylhydroxylase

SCOPe Domain Sequences for d1diic_:

Sequence; same for both SEQRES and ATOM records:

>d1diic_ a.3.1.1 (C:) p-Cresol methylhydroxylase, cytochrome c subunit {Pseudomonas putida [TaxId: 303]}
sqwgsgknlydkvcghchkpevgvgpvlegrglpeayikdivrngframpafpasyvdde
sltqvaeylsslp

Timeline for d1diic_:

• d1diic_ first appeared (with stable ids) in SCOP 1.55
  
• d1diic_ appears in SCOPe 2.07