SCOPe 2.02: Domain d1diqd_: 1diq D:

Lineage for d1diqd_ (1diq D:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein p-Cresol methylhydroxylase, cytochrome c subunit [46669] (1 species)
   the other subunit is a flavoprotein

7. Species Pseudomonas putida [TaxId:303] [46670] (2 PDB entries)

8. Domain d1diqd_: 1diq D: [15924]
   Other proteins in same PDB: d1diqa1, d1diqa2, d1diqb1, d1diqb2
   complexed with cl, fad, hem, pcr

Details for d1diqd_

PDB Entry: 1diq, 2.75 Å

PDB Description: crystal structure of p-cresol methylhydroxylase with substrate bound

PDB Compounds: (D:) p-cresol methylhydroxylase

SCOPe Domain Sequences for d1diqd_:

Sequence; same for both SEQRES and ATOM records:

>d1diqd_ a.3.1.1 (D:) p-Cresol methylhydroxylase, cytochrome c subunit {Pseudomonas putida [TaxId: 303]}
sqwgsgknlydkvcghchkpevgvgpvlegrglpeayikdivrngframpafpasyvdde
sltqvaeylsslpa

Timeline for d1diqd_:

• d1diqd_ first appeared (with stable ids) in SCOP 1.55
  
• d1diqd_ appears in SCOPe 2.01
  
• d1diqd_ appears in SCOPe 2.03
  
• d1diqd_ appears in the current release, SCOPe 2.08