SCOP 1.75: Domain d1dw2c_: 1dw2 C:

Lineage for d1dw2c_ (1dw2 C:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)

6. Protein SHP, an oxygen binding cytochrome c [46667] (1 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [46668] (4 PDB entries)

8. Domain d1dw2c_: 1dw2 C: [15922]
   complexed with hem, no

Details for d1dw2c_

PDB Entry: 1dw2, 2.2 Å

PDB Description: structure of the nitric oxide complex of reduced shp, an oxygen binding cytochrome c

PDB Compounds: (C:) cytochrome c

SCOP Domain Sequences for d1dw2c_:

Sequence; same for both SEQRES and ATOM records:

>d1dw2c_ a.3.1.1 (C:) SHP, an oxygen binding cytochrome c {Rhodobacter sphaeroides [TaxId: 1063]}
gdtspaqliagyeaaagapadaergralflstqtggkpdtpscttchgadvtragqtrtg
keiaplapsatpdrftdsarvekwlgrncnsvigrdctpgekadllawlaaq

Timeline for d1dw2c_:

• d1dw2c_ first appeared (with stable ids) in SCOP 1.55
  
• d1dw2c_ appears in SCOP 1.73
  
• d1dw2c_ appears in SCOPe 2.01
  
• d1dw2c_ appears in the current release, SCOPe 2.08