Class a: All alpha proteins [46456] (286 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
Protein SHP, an oxygen binding cytochrome c [46667] (1 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [46668] (4 PDB entries) |
Domain d1dw3b_: 1dw3 B: [15918] complexed with hem |
PDB Entry: 1dw3 (more details), 2.1 Å
SCOPe Domain Sequences for d1dw3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dw3b_ a.3.1.1 (B:) SHP, an oxygen binding cytochrome c {Rhodobacter sphaeroides [TaxId: 1063]} gdtspaqliagyeaaagapadaergralflstqtggkpdtpscttchgadvtragqtrtg keiaplapsatpdrftdsarvekwlgrncnsvigrdctpgekadllawlaaq
Timeline for d1dw3b_: