SCOPe 2.01: Domain d1gksa_: 1gks A:

Lineage for d1gksa_ (1gks A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome c551 [46660] (4 species)

7. Species Methylophilus methylotrophus, strain w3a1 [TaxId:17] [46664] (1 PDB entry)

8. Domain d1gksa_: 1gks A: [15909]
   complexed with hem

Details for d1gksa_

PDB Entry: 1gks

PDB Description: ectothiorhodospira halophila cytochrome c551 (reduced), nmr, 37 structures

PDB Compounds: (A:) cytochrome c551

SCOPe Domain Sequences for d1gksa_:

Sequence; same for both SEQRES and ATOM records:

>d1gksa_ a.3.1.1 (A:) Cytochrome c551 {Methylophilus methylotrophus, strain w3a1 [TaxId: 17]}
dgesiyingtaptcsschdrgvagapelnapedwadrpssvdelvestlagkgampaydg
radredlvkaieymlstl

Timeline for d1gksa_:

• d1gksa_ first appeared (with stable ids) in SCOP 1.55, called d1gks__
  
• d1gksa_ appears in SCOP 1.75
  
• d1gksa_ appears in SCOPe 2.02
  
• d1gksa_ appears in the current release, SCOPe 2.08